PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31362
Common NameKK1_030343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 335aa    MW: 37172.1 Da    PI: 9.0426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31362genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.48.9e-30200255156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r+ W+peLH++Fv+a++qLG +++AtPk+i+elm+v gLt+++vkSHLQkYRl+
  C.cajan_31362 200 KQRRSWSPELHRKFVDALQQLGRPQVATPKQIKELMQVVGLTNDEVKSHLQKYRLH 255
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.049197257IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-27198258IPR009057Homeodomain-like
SuperFamilySSF466895.01E-18198258IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-26200255IPR006447Myb domain, plants
PfamPF002492.1E-8202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEPNLDLSLA FVPISEILSE VSQGKDGSQK NEDFVQRLED EKRKIEAFKR ELPLCMMIVN  60
DVISRLKGEI KGVRMQDKPV VEELVPLMET NSEENGSLIA RKEKSSDTKK WMNLFPLCNA  120
ETNPKETDES GGTSSLAFNG NKCVSKTVMR DDKVPSLGLT TPMFELNHRK TESGCGHSSS  180
LITSPVKSKG QLQSLQNTKK QRRSWSPELH RKFVDALQQL GRPQVATPKQ IKELMQVVGL  240
TNDEVKSHLQ KYRLHFKRPQ VCSNGQGNNR NSGLGMMAED KSKGNLSQSG SPQGPLFLGG  300
SGKGLSSSGR NSTETEEDEQ SDCRNWKGGL HPTRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0969302e-62BT096930.1 Soybean clone JCVI-FLGm-21I16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155959.11e-135hypothetical protein PHAVU_003G246900g
TrEMBLA0A151RZJ00.0A0A151RZJ0_CAJCA; Two-component response regulator ARR1
STRINGGLYMA17G20520.21e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-45G2-like family protein